شنتشن Haiwen Biotechnology Co.، Ltd. هو تصنيع مسحوق المنشطات الخام ، والزيوت شبه النهائية ، السائل النهائي ، هرمون النمو ، الببتيدات والمخدرات المحلية في الصين.

المبيعات والدعم الفنى
طلب اقتباس -
Select Language
منزل
المنتجات
حول بنا
جولة في المعمل
ضبط الجودة
اتصل بنا
طلب اقتباس
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
منزلالمنتجات

مسحوق نمو الشعر

لقد استلمت منتجاتي ، فالتعبئة لا تفي بالحصافة والكمال ، فقد أدهشني حقًا ، وسوف أطلب المزيد منك في أقرب وقت ممكن. تكس!

—— Robet--Australia

لقد تعاونت معك لمرات عديدة ، جودة المنتج الخاص بك كبيرة جدا ، ولهذا السبب ما زلت أشتري المنتجات منك. شكرا جزيلا

—— Richard---American

مرحبا ماتي ، أفضل الأسعار الخاصة بك ومنتجات عالية النقاوة تنافسي للغاية في بلدي ، وهذا اسمحوا لي أن كسب الكثير من الربح ، زبائني حقا مثل ذلك.

—— Johnson---Canada

ابن دردش الآن

مسحوق نمو الشعر

(115)
الصين 99.5 ٪ عالية النقاء المينوكسيديل USP34 نمو الشعر مسحوق الدوائية CAS 38304-91-5 موزع

99.5 ٪ عالية النقاء المينوكسيديل USP34 نمو الشعر مسحوق الدوائية CAS 38304-91-5

99.5 ٪ عالية النقاء المينوكسيديل USP34 نمو الشعر مسحوق الدوائية CAS 38304-91-5 تفصيل سريع: Minoxidil أو Minoxidil sulphate هو نوع من Hypotensive ، مما يقلل من ضغط الدم ، تعزيز نمو الشعر الخارجي. وصف: مينوكسيديل ...    قراءة المزيد
2019-03-13 17:06:34
الصين مسحوق BPH نمو الشعر Avodart / دوتاستيريدي 164656-23-9 Duagen موزع

مسحوق BPH نمو الشعر Avodart / دوتاستيريدي 164656-23-9 Duagen

مسحوق BPH نمو الشعر Avodart / دوتاستيريدي 164656-23-9 Duagen دوتاستيديدي (أفودارت) اسم المنتج: دوتاستيريدي الوزن الجزيئي: L28.5297 InChI: nChI = 1 / C27H30F6N2O2 / c1-24-11-9-17-15 (4-8-21-25 (17،2) 12-10-22 ...    قراءة المزيد
2019-03-13 17:06:29
الصين حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide موزع

حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide

حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide تفصيل سريع: اسم المنتج: Sermorelin المرادفات: SERMORELIN ؛ SERMORELIN ACETATE ؛ YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 ؛ TYR-ALA-ASP-ALA-ILE...    قراءة المزيد
2019-03-13 17:06:33
الصين عن طريق الفم Hongdenafil نمو الشعر مسحوق أبيض بلوري CAS 98319-26-7 موزع

عن طريق الفم Hongdenafil نمو الشعر مسحوق أبيض بلوري CAS 98319-26-7

عن طريق الفم Hongdenafil نمو الشعر مسحوق أبيض بلوري CAS 98319-26-7 تفصيل سريع: اسم المنتج Hongdenafil اسم آخر Acetildenafil رقم سجل CAS 831217-01-7 الصيغة الجزيئية C25H34N6O3 الوزن الجزيئي الغرامي 466،583 مظهر ...    قراءة المزيد
2019-03-13 17:06:25
الصين كمنشط جنسي الببتيد الأبيض نمو الشعر الستيرويد PT141 خلات CAS 32780-32-8 موزع

كمنشط جنسي الببتيد الأبيض نمو الشعر الستيرويد PT141 خلات CAS 32780-32-8

كمنشط جنسي الببتيد الأبيض نمو الشعر الستيرويد PT141 خلات CAS 32780-32-8 تفصيل سريع: Bremelanotide. PT-141 رقم السجل التجاري: 32780-32-8 موك: 20 قيراط النقاوة (HPLC): 98.0٪ min. الصيغة الجزيئية: C50H68N14O10 الو...    قراءة المزيد
2019-03-13 17:06:27
الصين الصحة 99 ٪ نمو الشعر مسحوق دوتاستيريدي Avodart مكافحة الاستروجين المنشطات موزع

الصحة 99 ٪ نمو الشعر مسحوق دوتاستيريدي Avodart مكافحة الاستروجين المنشطات

الصحة 99 ٪ نمو الشعر مسحوق دوتاستيريدي Avodart مكافحة الاستروجين المنشطات تفصيل سريع: اسم المنتج ؛ دوتاستيريدي الاسم المستعار، AVODART CAS No.164656-23-9 الصيغة الجزيئية ؛ C27H30F6N2O2 الوزن الجزيئي ؛ 528.53 ال...    قراءة المزيد
2019-03-13 17:06:20
الصين بلوري أبيض نمو الشعر الصلبة الستيرويد فيناستريد بروسكار مكافحة الاستروجين المنشطات موزع

بلوري أبيض نمو الشعر الصلبة الستيرويد فيناستريد بروسكار مكافحة الاستروجين المنشطات

بلوري أبيض نمو الشعر الصلبة الستيرويد فيناستريد بروسكار مكافحة الاستروجين المنشطات تفصيل سريع: اسم المنتج: فيناسترايد الاسم المستعار: Proscar CAS: 98319-26-7 MF: C23H36N2O2 ميغاواط: 372.55 الطهارة: 99.68٪ المظه...    قراءة المزيد
2019-03-13 17:06:20
الصين 98319-26-7 نمو الشعر مسحوق Finasteride Propecia علاج تساقط الشعر موزع

98319-26-7 نمو الشعر مسحوق Finasteride Propecia علاج تساقط الشعر

98319-26-7 نمو الشعر مسحوق Finasteride Propecia علاج تساقط الشعر تفصيل سريع: اسم المنتج فيناستريد رقم سجل CAS 98319-26-7 الصيغة الجزيئية C23H36N2O2 الوزن الجزيئي الغرامي 372.5441 InChI : InChI = 1 / C23H36N2O2 ...    قراءة المزيد
2019-03-13 17:06:02
الصين قوية العشبية استخراج نمو الشعر الستيرويد مينوكسيديل CAS 38304-91-5 موزع

قوية العشبية استخراج نمو الشعر الستيرويد مينوكسيديل CAS 38304-91-5

قوية العشبية استخراج نمو الشعر الستيرويد مينوكسيديل CAS 38304-91-5 عزيزي ، لقد صدرت SMQ مثل هذا المنتجات لمدة 12 عاما ، عالية الجودة مع سعر جيد واستجابة سريعة ، مرحبا بكم في الاتصال ycsmq@yuanchengtech.com سكاي...    قراءة المزيد
2019-03-13 17:06:09
الصين طبيعي مسحوق نمو الشعر 57-85-2 Testoviron تستوستيرون بروبيونات مساحيق موزع

طبيعي مسحوق نمو الشعر 57-85-2 Testoviron تستوستيرون بروبيونات مساحيق

طبيعي مسحوق نمو الشعر 57-85-2 Testoviron تستوستيرون بروبيونات مساحيق 1. سريع التفاصيل: الاسم الانكليزي: التستوستيرون بروبيونات الاسم باللغة الإنجليزية: 17beta- (Propionyloxy) androst-4-en-3-one؛ 17beta-Hydroxy...    قراءة المزيد
2019-03-13 17:06:15
Page 1 of 12 |< << 1  2  3  4  5  6  7  8  9  10  >> >|