شنتشن Haiwen Biotechnology Co.، Ltd. هو تصنيع مسحوق المنشطات الخام ، والزيوت شبه النهائية ، السائل النهائي ، هرمون النمو ، الببتيدات والمخدرات المحلية في الصين.

المبيعات والدعم الفنى
طلب اقتباس -
Select Language
منزل
المنتجات
حول بنا
جولة في المعمل
ضبط الجودة
اتصل بنا
طلب اقتباس
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
منزلالمنتجاتمسحوق نمو الشعر

حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide

لقد استلمت منتجاتي ، فالتعبئة لا تفي بالحصافة والكمال ، فقد أدهشني حقًا ، وسوف أطلب المزيد منك في أقرب وقت ممكن. تكس!

—— Robet--Australia

لقد تعاونت معك لمرات عديدة ، جودة المنتج الخاص بك كبيرة جدا ، ولهذا السبب ما زلت أشتري المنتجات منك. شكرا جزيلا

—— Richard---American

مرحبا ماتي ، أفضل الأسعار الخاصة بك ومنتجات عالية النقاوة تنافسي للغاية في بلدي ، وهذا اسمحوا لي أن كسب الكثير من الربح ، زبائني حقا مثل ذلك.

—— Johnson---Canada

ابن دردش الآن

حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide

حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide المزود حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide المزود

صورة كبيرة :  حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide

تفاصيل المنتج:

مكان المنشأ:الصين
اسم العلامة التجارية:SMQ
إصدار الشهادات:USP,SGS
رقم الموديل:86168-78-7

شروط الدفع والشحن:

الحد الأدنى لكمية:1KG
الأسعار:USD 10g
تفاصيل التغليف:كما كنت المطلوبة
وقت التسليم:1-3 يوم
شروط الدفع:ويسترن يونيون, Moneygram, T/T
القدرة على العرض:1000KG / الأسبوع
مفصلة وصف المنتج
اسم: سيرموريلين معادلة: C149H246N44O42S
تطبيق: الببتيد طبل مظهر: مسحوق مجفف بالتجميد
سكايب: nicole0918 البريد الإلكتروني: 2355935183@ycphar.com

حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide

تفصيل سريع:


اسم المنتج: Sermorelin
المرادفات: SERMORELIN ؛ SERMORELIN ACETATE ؛ YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 ؛ TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG -LYS-LEU-LEU-GLN-ASP-إيل-MET-SER-ARG-NH2، TYR-ALA-ASP-ALA-إيل-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-الغليسين -GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN؛ H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN- SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2؛ FOWO HORMONE RELEASING FACTOR (1 -29) ، وآميدي ، و HUMAN ؛ GRF (1-29) AmIDE (HUMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
فئات المنتجات: مشتقات الأحماض الأمينية ؛ الببتيد ؛ GH-RHObesity Research ؛ GH-RHPeptides لعلم الأحياء الخلوي ؛ عوامل إطلاق هرمون النمو ؛ Neuropeptides ؛ Neurotransmission (السمنة) ؛ العوامل المؤثرة
الاستعمال: الزانثين أوكسيديز المانع


عملية التعبئة والتغليف والتسليم:

1. التسليم: سيتم ترتيب الطرود في غضون 12 ساعة على استلام المبلغ الخاص بك.
2. التعبئة: سوف توضع مساحيق ستيرويد تكتم بما فيه الكفاية لعبر الجمارك
3. worldwide بأمان. التعبئة مثل الأغذية الصينية التقليدية ، وغسل والاستحمام البنود وغيرها من المعدات ، وما إلى ذلك ...
4. خدمة إضافية: سيتم توفير صور من حزمة لك أن نقول بصرف النظر المنشطات.
5. وسيتم تقديم عدد تتبع بمجرد أن يتم تحريرها.
6. بعد البيع: أي أسئلة بعد حصلت على الطرد ، يرجى الاتصال بنا لأول مرة. سوف تحل المشاكل بالنسبة لك على الفور.

ميزة تنافسية:

  1. تجربة غنية في تحميل كمية كبيرة من الحاويات في الميناء البحري الصيني ؛
  2. شحن سريع عن طريق خط الشحن حسن السمعة.
  3. التغليف مع المنصات وفقا للطلب الخاص للمشترين ؛
  4. تقديم أفضل خدمة بعد الشحن عن طريق البريد الإلكتروني ؛
  5. الشحنات مع خدمة بيع الحاويات المتاحة ؛
  6. توفير صور البضائع قبل وبعد التحميل في الحاوية ؛
  7. مواد خام من أصل صيني ؛

منتجات ذات صله:

سلسلة ببتيد

اسم المنتج

تخصيص

MGF

2mg / قارورة

PEG MGF

2mg / قارورة

CJC-1295 مع DAC

2mg / قارورة

CJC-1295 بدون DAC

2mg / قارورة

PT-141

10mg / قارورة

MT-1

10mg / قارورة

MT-2

10mg / قارورة

GHRP-2

10mg / قارورة

GHRP-2

5mg / قارورة

GHRP-6

10mg / قارورة

GHRP-6

5mg / قارورة

Ipamorelin

2mg / قارورة

Hexarelin

2mg / قارورة

Sermorelin

2mg / قارورة

الأوكسيتوسين

2mg / قارورة

TB500

2mg / قارورة

pentadecapeptide BPC 157

2mg / قارورة

HGH 176-191

2mg / قارورة

تريبتوريلين 2mg / قارورة
تيسامورلين 2mg / قارورة
Gonadorelin 2mg / قارورة
Gonadorelin 10mg / قارورة
DSIP 2mg / قارورة
Selank 5mg / قارورة



تفاصيل الاتصال
Shenzhen Haiwen Biotechnology Co.,Ltd

اتصل شخص: Mrs. Lisa

إرسال استفسارك مباشرة لنا (0 / 3000)

منتجات أخرى

99.5 ٪ عالية النقاء المينوكسيديل USP34 نمو الشعر مسحوق الدوائية CAS 38304-91-5

مسحوق BPH نمو الشعر Avodart / دوتاستيريدي 164656-23-9 Duagen

حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide

عن طريق الفم Hongdenafil نمو الشعر مسحوق أبيض بلوري CAS 98319-26-7

كمنشط جنسي الببتيد الأبيض نمو الشعر الستيرويد PT141 خلات CAS 32780-32-8

الصحة 99 ٪ نمو الشعر مسحوق دوتاستيريدي Avodart مكافحة الاستروجين المنشطات

بلوري أبيض نمو الشعر الصلبة الستيرويد فيناستريد بروسكار مكافحة الاستروجين المنشطات