شنتشن Haiwen Biotechnology Co.، Ltd. هو تصنيع مسحوق المنشطات الخام ، والزيوت شبه النهائية ، السائل النهائي ، هرمون النمو ، الببتيدات والمخدرات المحلية في الصين.

المبيعات والدعم الفنى
طلب اقتباس -
Select Language
حول بنا
جولة في المعمل
ضبط الجودة
اتصل بنا
طلب اقتباس

steroids for hair growth

لقد استلمت منتجاتي ، فالتعبئة لا تفي بالحصافة والكمال ، فقد أدهشني حقًا ، وسوف أطلب المزيد منك في أقرب وقت ممكن. تكس!

—— Robet--Australia

لقد تعاونت معك لمرات عديدة ، جودة المنتج الخاص بك كبيرة جدا ، ولهذا السبب ما زلت أشتري المنتجات منك. شكرا جزيلا

—— Richard---American

مرحبا ماتي ، أفضل الأسعار الخاصة بك ومنتجات عالية النقاوة تنافسي للغاية في بلدي ، وهذا اسمحوا لي أن كسب الكثير من الربح ، زبائني حقا مثل ذلك.

—— Johnson---Canada

ابن دردش الآن

steroids for hair growth


بلوري أبيض نمو الشعر الصلبة الستيرويد فيناستريد بروسكار مكافحة الاستروجين المنشطات

بلوري أبيض نمو الشعر الصلبة الستيرويد فيناستريد بروسكار مكافحة الاستروجين المنشطات تفصيل سريع: اسم المنتج: فيناسترايد الاسم المستعار: Proscar CAS: 98319-26-7 MF: C23H36N2O2 ميغاواط: 372.55 الطهارة: 99.68٪ المظه...قراءة المزيد
2019-03-13 17:06:20

علاج تساقط الشعر الدوائية مينوكسيديل 99٪ مين نمو الشعر مسحوق 38304-91-5

علاج تساقط الشعر الدوائية مينوكسيديل 99٪ مين نمو الشعر مسحوق 38304-91-5 1. الوصف الأساسي: مينوكسيديل هو دواء عائي خافض للضغط. كما يبطئ أو يوقف تساقط الشعر ويعزز نمو الشعر. الآن خارج براءات الاختراع ، وهي متاحة ...قراءة المزيد
2019-03-13 17:06:04

علاج تساقط الشعر الدوائية مينوكسيديل Purity 99٪ مين نمو الشعر مسحوق CAS 38304-91-5

علاج تساقط الشعر الدوائية مينوكسيديل 99٪ مين نمو الشعر مسحوق 38304-91-5 1. الوصف الأساسي: مينوكسيديل هو دواء عائي خافض للضغط. كما يبطئ أو يوقف تساقط الشعر ويعزز نمو الشعر. الآن خارج براءات الاختراع ، وهي متاحة ...قراءة المزيد
2019-03-13 17:06:13

هرمون التستوستيرون إينونثات نمو الشعر مسحوق هرمون BodyBuilding 315-37-7

هرمون التستوستيرون إينونثات نمو الشعر مسحوق هرمون BodyBuilding 315-37-7 1. سريع التفاصيل: اسم المنتج التستوستيرون إينونثات مصنع توريد اسم آخر التستوستيرون enantate. التستوستيرون enthanoate؛ Primoteston رقم سجل ...قراءة المزيد
2019-03-13 17:06:15

مسحوق مخدر نمو الشعر Proscar Anodyne 98319-26-7 Finasteride ، Prostide

مسحوق نمو الشعر الآمن Proscar المخدرات مخدر موضعي Anodyne CAS 98319-26-7 Finasteride ، Prostide 1. سريع التفاصيل: اسم المنتج مصنع Formestane توريد اسم آخر Lentaron. 4-هيدروكسي-androst-4-إيني-17-ديون. 4-هيدروكسي ...قراءة المزيد
2019-03-13 17:06:14

Dutasteride نمو الشعر الستيرويد هرمون مسحوق Avodart لعلاج تساقط الشعر

عرف نفسك قدم نفسك: شركتنا قد تم القيام بهذا الخط لأكثر من 10 سنوات ، ونحن من ذوي الخبرة مع المنتج الخاص ، والشحن الآمن والنجاح العالي لتمرير الجمارك ، ونرحب هنا للتشاور: البريد الإلكتروني: ariesfeng@ycphar.com ...قراءة المزيد
2019-03-13 17:06:06

Dutasteride Avodart نمو الشعر الستيرويد 99 ٪ فارما الصف 164656-23-9

Dutasteride Avodart نمو الشعر الستيرويد 99 ٪ فارما الصف 164656-23-9 الوصف الأساسي: Dutasteride (Avodart) ، الذي تم تصنيعه بواسطة GlaxoSmithKline ، هو مثبط ثنائي إنزيم 5-α المختزل الذي يمنع تحويل التستوستيرون إل...قراءة المزيد
2019-03-13 17:06:13

تضخم البروستاتا علاج نمو الشعر الستيرويد 164656-23-9 Duagen

تضخم البروستاتا علاج نمو الشعر الستيرويد 164656-23-9 Duagen 1. سريع التفاصيل: دوتاستيريدي الاسم المستعار: افودارت. Duagen CAS NO: 164656-23-9 MF: C27H30F6N2O2 ميغاواط: 528.53 الطهارة: 99٪ المظهر: مسحوق أبيض. يس...قراءة المزيد
2019-03-13 17:06:15

فيناستريد نمو الشعر هرمون مسحوق هرمون Proscar / بروبيكيا

عرف نفسك قدم نفسك: شركتنا قد تم القيام بهذا الخط لأكثر من 10 سنوات ، ونحن من ذوي الخبرة مع المنتج الخاص ، والشحن الآمن والنجاح العالي لتمرير الجمارك ، ونرحب هنا للتشاور: البريد الإلكتروني: ariesfeng@ycphar.com ...قراءة المزيد
2019-03-13 17:06:06

حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide

حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide تفصيل سريع: اسم المنتج: Sermorelin المرادفات: SERMORELIN ؛ SERMORELIN ACETATE ؛ YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 ؛ TYR-ALA-ASP-ALA-ILE...قراءة المزيد
2019-03-13 17:06:33
Page 1 of 10 |< << 1  2  3  4  5  6  7  8  9  10  >> >|