شنتشن Haiwen Biotechnology Co.، Ltd. هو تصنيع مسحوق المنشطات الخام ، والزيوت شبه النهائية ، السائل النهائي ، هرمون النمو ، الببتيدات والمخدرات المحلية في الصين.

المبيعات والدعم الفنى
طلب اقتباس -
Select Language
منزل
المنتجات
حول بنا
جولة في المعمل
ضبط الجودة
اتصل بنا
طلب اقتباس
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
منزلالمنتجات

hair growth steroid

لقد استلمت منتجاتي ، فالتعبئة لا تفي بالحصافة والكمال ، فقد أدهشني حقًا ، وسوف أطلب المزيد منك في أقرب وقت ممكن. تكس!

—— Robet--Australia

لقد تعاونت معك لمرات عديدة ، جودة المنتج الخاص بك كبيرة جدا ، ولهذا السبب ما زلت أشتري المنتجات منك. شكرا جزيلا

—— Richard---American

مرحبا ماتي ، أفضل الأسعار الخاصة بك ومنتجات عالية النقاوة تنافسي للغاية في بلدي ، وهذا اسمحوا لي أن كسب الكثير من الربح ، زبائني حقا مثل ذلك.

—— Johnson---Canada

ابن دردش الآن

hair growth steroid

(232)

Dutasteride Avodart نمو الشعر الستيرويد 99 ٪ فارما الصف 164656-23-9

Dutasteride Avodart نمو الشعر الستيرويد 99 ٪ فارما الصف 164656-23-9 الوصف الأساسي: Dutasteride (Avodart) ، الذي تم تصنيعه بواسطة GlaxoSmithKline ، هو مثبط ثنائي إنزيم 5-α المختزل الذي يمنع تحويل التستوستيرون إل...قراءة المزيد
2019-03-13 17:06:13

قوية العشبية استخراج نمو الشعر الستيرويد مينوكسيديل CAS 38304-91-5

قوية العشبية استخراج نمو الشعر الستيرويد مينوكسيديل CAS 38304-91-5 عزيزي ، لقد صدرت SMQ مثل هذا المنتجات لمدة 12 عاما ، عالية الجودة مع سعر جيد واستجابة سريعة ، مرحبا بكم في الاتصال ycsmq@yuanchengtech.com سكاي...قراءة المزيد
2019-03-13 17:06:09

تضخم البروستاتا علاج نمو الشعر الستيرويد 164656-23-9 Duagen

تضخم البروستاتا علاج نمو الشعر الستيرويد 164656-23-9 Duagen 1. سريع التفاصيل: دوتاستيريدي الاسم المستعار: افودارت. Duagen CAS NO: 164656-23-9 MF: C27H30F6N2O2 ميغاواط: 528.53 الطهارة: 99٪ المظهر: مسحوق أبيض. يس...قراءة المزيد
2019-03-13 17:06:15

كمنشط جنسي الببتيد الأبيض نمو الشعر الستيرويد PT141 خلات CAS 32780-32-8

كمنشط جنسي الببتيد الأبيض نمو الشعر الستيرويد PT141 خلات CAS 32780-32-8 تفصيل سريع: Bremelanotide. PT-141 رقم السجل التجاري: 32780-32-8 موك: 20 قيراط النقاوة (HPLC): 98.0٪ min. الصيغة الجزيئية: C50H68N14O10 الو...قراءة المزيد
2019-03-13 17:06:27

صحي نمو الشعر الستيرويد 98 ٪ دابوكسيتين للمعالجة PE المؤسسة الموحدة

صحي نمو الشعر الستيرويد 98 ٪ دابوكسيتين للمعالجة PE المؤسسة الموحدة 1. سريع التفاصيل: 1. CAS رقم: 119356-77-3 2. MF: C21H23NO 3. MW: 305.4134 4. الفحص: 98٪ 5. المظهر: مسحوق بلوري أبيض 6. الاستخدام: تعزيز الذكور ...قراءة المزيد
2019-03-13 17:06:14

Dutasteride نمو الشعر الستيرويد هرمون مسحوق Avodart لعلاج تساقط الشعر

عرف نفسك قدم نفسك: شركتنا قد تم القيام بهذا الخط لأكثر من 10 سنوات ، ونحن من ذوي الخبرة مع المنتج الخاص ، والشحن الآمن والنجاح العالي لتمرير الجمارك ، ونرحب هنا للتشاور: البريد الإلكتروني: ariesfeng@ycphar.com ...قراءة المزيد
2019-03-13 17:06:06

بلوري أبيض نمو الشعر الصلبة الستيرويد فيناستريد بروسكار مكافحة الاستروجين المنشطات

بلوري أبيض نمو الشعر الصلبة الستيرويد فيناستريد بروسكار مكافحة الاستروجين المنشطات تفصيل سريع: اسم المنتج: فيناسترايد الاسم المستعار: Proscar CAS: 98319-26-7 MF: C23H36N2O2 ميغاواط: 372.55 الطهارة: 99.68٪ المظه...قراءة المزيد
2019-03-13 17:06:20

علاج تساقط الشعر الدوائية مينوكسيديل 99٪ مين نمو الشعر مسحوق 38304-91-5

علاج تساقط الشعر الدوائية مينوكسيديل 99٪ مين نمو الشعر مسحوق 38304-91-5 1. الوصف الأساسي: مينوكسيديل هو دواء عائي خافض للضغط. كما يبطئ أو يوقف تساقط الشعر ويعزز نمو الشعر. الآن خارج براءات الاختراع ، وهي متاحة ...قراءة المزيد
2019-03-13 17:06:04

علاج تساقط الشعر الدوائية مينوكسيديل Purity 99٪ مين نمو الشعر مسحوق CAS 38304-91-5

علاج تساقط الشعر الدوائية مينوكسيديل 99٪ مين نمو الشعر مسحوق 38304-91-5 1. الوصف الأساسي: مينوكسيديل هو دواء عائي خافض للضغط. كما يبطئ أو يوقف تساقط الشعر ويعزز نمو الشعر. الآن خارج براءات الاختراع ، وهي متاحة ...قراءة المزيد
2019-03-13 17:06:13

حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide

حقن مجفف بالتجميد 2mg / فيال نمو الشعر الستيرويد Sermorelin Polypeptide تفصيل سريع: اسم المنتج: Sermorelin المرادفات: SERMORELIN ؛ SERMORELIN ACETATE ؛ YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 ؛ TYR-ALA-ASP-ALA-ILE...قراءة المزيد
2019-03-13 17:06:33
Page 1 of 10 |< << 1  2  3  4  5  6  7  8  9  10  >> >|